PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G010669_P01
Common NameZEAMMB73_964336
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MIKC_MADS
Protein Properties Length: 270aa    MW: 30413.6 Da    PI: 8.5857
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G010669_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.64.4e-30958150
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                       krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyey+
  GRMZM2G010669_P01  9 KRIENNTSRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYA 58
                       79***********************************************8 PP

2K-box90.33.4e-3080160685
              K-box   6 gks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 
                        g   le++ ++ +qqe+akL+++i++Lq+++Rhl+G+++++LslkeL+qLe++Lek+++kiR++K+ell ++i+++ +ke+
  GRMZM2G010669_P01  80 GPPlLEHNAQQFYQQESAKLRNQIQMLQNTNRHLVGDSVGNLSLKELKQLESRLEKGISKIRARKSELLAAEINYMGQKEN 160
                        4556788899*******************************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.417161IPR002100Transcription factor, MADS-box
SMARTSM004322.6E-40160IPR002100Transcription factor, MADS-box
CDDcd002651.84E-45278No hitNo description
SuperFamilySSF554553.27E-32275IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-32323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-323859IPR002100Transcription factor, MADS-box
PfamPF014862.6E-2285161IPR002487Transcription factor, K-box
PROSITE profilePS5129712.91689184IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGRGRIEIKR IENNTSRQVT FCKRRNGLLK KAYELSVLCD AEVALVVFSS RGRLYEYANN  60
SVKATIERYK KAHAVGSSSG PPLLEHNAQQ FYQQESAKLR NQIQMLQNTN RHLVGDSVGN  120
LSLKELKQLE SRLEKGISKI RARKSELLAA EINYMGQKEN LSFQMDTWNL QTRYGIAIEE  180
GEQQLQQVTV AQSVAAAAAT DVELNPFLEM DTKCFFPGGP FATLDMKCFF PGSLQMLEAQ  240
QRQMLATELN LGYQLAPPDT DVANNNPQQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-19169169Myocyte-specific enhancer factor 2B
1tqe_Q1e-19169169Myocyte-specific enhancer factor 2B
1tqe_R1e-19169169Myocyte-specific enhancer factor 2B
1tqe_S1e-19169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.963150.0ear| embryo| endosperm| ovary| pedicel| pericarp| tassel
Zm.101450.0aerial organ| ear| embryo| endosperm| glume| meristem| pericarp| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G010669
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G010669_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0365260.0BT036526.1 Zea mays full-length cDNA clone ZM_BFb0120G12 mRNA, complete cds.
GenBankBT0390740.0BT039074.1 Zea mays full-length cDNA clone ZM_BFb0368I18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105379.20.0uncharacterized protein LOC542326
SwissprotQ2QW531e-113MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBLK7TYN60.0K7TYN6_MAIZE; Putative MADS-box transcription factor family protein isoform 1
STRINGGRMZM2G010669_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.13e-77MIKC_MADS family protein